Recombinant Influenza A Hemagglutinin protein (His tag) Strain Perth/16/09 (ab217652)

Description

  • Product name

    Recombinant Influenza A Hemagglutinin protein (His tag) Strain Perth/16/09
    See all Influenza A Hemagglutinin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      KLPGNDNSTATLCLGHHAVPNGTIVKTITNDQIEVTNATELVQSSSTGEI CDSPHQILDGKNCTLIDALLGDPQCDGFQNKKWDLFVERSKAYSNCYPYD VPDYASLRSLVASSGTLEFNNESFNWTGVTQNGTSSACIRRSKNSFFSRL NWLTHLNFKYPALNVTMPNNEQFDKLYIWGVHHPGTDKDQIFLYAQASGR ITVSTKRSQQTVSPNIGSRPRVRNIPSRISIYWTIVKPGDILLINSTGNL IAPRGYFKIRSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRIT YGACPRYVKQNTLKLATGMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWY GFRHQNSEGRGQAADLKSTQAAIDQINGKLNRLIGKTNEKFHQIEKEFSE VEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKT KKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQ IKGVELKSGYKD
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      18 to 529
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Influenza A (A/Perth/16/2009(H3N2).
  • Description

    Recombinant Influenza A Hemagglutinin protein (His tag)

Specifications

Our Abpromise guarantee covers the use of ab217652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: 100% PBS

Images

  • SDS-PAGE analysis of ab217652.

References

ab217652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Recombinant Hemagglutinin protein (His tag), ab217652, was run on a Western blot (MW approx 75kDa). Band was successfully detected with a primary antibody to the HA tag, Biolegend Purified anti-HA.11 Epitope Tag Antibody, cat#901501 , raised against the antigen CYPYDVPDYASL. Secondary antibody was IRDye® 800CW Goat anti-Mouse IgG (LI-COR P/n 925-32210).

Becky Leifer

Verified customer

Submitted Jun 05 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up