Description

  • Product name

    Recombinant Influenza A Influenza A Virus Nucleoprotein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Influenza A
    • Sequence

      MASQGTKRSYEQMETDGERQNATEIRASVGKMIDGIGRFYIQMCTELKLS DYEGRLIQNSLTVERMVLSAFDERRNRYLEEHPSAGKDPKKTGGPIYKRV GGRWMRELVLYDKEEIRRIWRQANNGDDATRGLTHMMIWHSNLNDTTYQR TRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGIGTMVMELIRMIKRG INDRNFWRGENGRKTRSAYERMCNILKGKFQTAAQRAMMDQVRESRNPGN AEIEDLIFSARSALILRGSVAHKSCLPACVYGPAVSSGYDFEKEGYSLVG IDPFKLLQNSQVYSLIRPNENPAHKSQLVWMACHSAAFEDLRLLSFIRGT KVSPRGKLSTRGVQIASNENMDNMESSTLELRSRYWAIRTRSGGNTNQQR ASAGQISVQPTFSVQRNLPFEKSTVMAAFTGNTEGRTSDMRAEIIRMMEG AKPEEVSFRGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDNAEEYDN
    • Predicted molecular weight

      72 kDa including tags
    • Amino acids

      1 to 498
    • Tags

      His tag N-Terminus
    • Additional sequence information

      6xHis-SUMO tag at N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab224859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Common flu NP
    • Influenza A virus NP
    • NP
    • Nucleocapsid protein
    • Nucleoprotein
    • Protein N
    • Seasonal Influenza A (H1N1) Nucleocapsid Protein
    see all
  • Relevance

    The nucleoprotein (NP) of Influenza virus encapsulates the negative strand of the viral RNA and is essential for replicative transcription. It may also be involved in other essential functions throughout the virus life cycle. As well as binding ssRNA, NP is able to self associate to form large oligomeric complexes. NP is able to interact with a variety of other macromolecules of both viral and cellular origins. It binds the PB1 and PB2 subunits of the polymerase and the matrix protein M1. "NP has also been shown to interact with at least four cellular polypeptide families: nuclear import receptors of the importin class, filamentous (F) actin, the nuclear export receptor CRM1 and a DEAD box helicase BAT1/UAP56" (Portela et al 2002).
  • Cellular localization

    Host cell nucleus

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab224859 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab224859 could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/Beijing/353/1989 H3N2) Nucleoprotein.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab224859 could indicate that this peptide derived from E.coli-expressed Influenza A virus (strain A/Beijing/353/1989 H3N2) Nucleoprotein.

References

ab224859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up