Recombinant Influenza A Nucleoprotein (His tag) (ab214834)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Influenza A
    • Sequence

      MASQGTKRSYEQMETDGDRQNATEIRASVGKMIDGIGRFYIQMCTELKLS DHEGRLIQNSLTIEKMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRV DGKWMRELVLYDKEEIRRIW RQANNGEDATSGLTHIMIWHSNLNDATY QRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGIGTMVMELIRMVK RGINDRNFWRGENGRKTRSAYERMCNILKGKFQTAAQRAMVD QVRESR NPGNAEIEDLIFLARSALILRGSVAHKSCLPACAYGPAVSSGYDFEKEGY SLVGIDPFKLLQNSQIYSLIRPNENPAHKSQLVWMACHSAAFEDLRLLSF IRGTKVSPRGKLST RGVQIASNENMDNMGSSTLELRSGYWAIRTRSGG NTNQQRASAGQTSVQPTFSVQRNLPF EKSTIMAAFTGNTEGRTSDMRA EIIRMMEGAKPEEVSFRGRGVFELSDEKATNPIVPSFDMSNEGSYFFGDN AEEYDN
    • Molecular weight

      57 kDa including tags
    • Amino acids

      1 to 498
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (A/Brisbane/10/2007) (H3N2) (Genebank No. CY035025).

Specifications

Our Abpromise guarantee covers the use of ab214834 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: PBS, 0.1% BSA, 25% Glycerol

Images

  • 4-20% SDS-PAGE analysis of ab214834.

References

ab214834 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214834.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up