Description

  • Product name

    Recombinant Influenza A Virus protein (His tag)
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      DTICIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDSHNGKLCRLKGIAPL QLGKCNIAGWLLGNPECDPLLPVRSWSYIVETPNSENGICYPGDFIDYEE LREQLSSVSSFERFEIFPKESSWPNHNTTKGVTAACSHAGKSSFYRNLLW LTEKEGSYPKLKNSYVNKKGKEVLVLWGIHHPSNSKDQQNIYQNENAYVS VVTSNYNRRFTPEIAERPKVRDQAGRMNYYWTLLKPGDTIIFEANGNLIA PRYAFALSRGFGSGIITSNASMHECNTKCQTPLGAINSSLPFQNIHPVTI GECPKYVRSAKLRMVTGLRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYG YHHQNEQGSGYAADQKSTQNAINGITNKVNSVIEKMNIQFTAVGKEFNKL EKRMENLNKKVDDGFLDIWTYNAELLVLLENERTLDFHDSNVKNLYEKVK SQLKNNAKEIGNGCFEFYHKCDNECMESVRNGTYDYPKYSEESKLNREKV DGVKLESMGIYQ
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      18 to 529
    • Tags

      His tag C-Terminus
    • Additional sequence information

      A/Puerto Rico/8/1934 (H1N1) strain. 8x Gly-Ser linker and His tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab228324 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: PBS

    0.2 um filter sterilized.

General Info

  • Relevance

    Influenza A and B are the two types of influenza viruses that cause epidemic human disease. Influenza type C infections cause a mild respiratory illness and are not thought to cause epidemics. Influenza A viruses are further categorized into subtypes on the basis of two surface antigens: hemagglutinin (H) and neuraminidase (N). Strains are also described by geographic origin, strain number and year of isolation.
  • Cellular localization

    Nuclear

References

ab228324 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab228324.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up