Description

  • Product name

    Recombinant Influenza B Virus Hemagglutinin protein (His tag)
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 10.000 Eu/mg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      DRICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTPTKSYFANLKGTRTR GKLCPDCLNCTDLDVALGRPMCVGTTPSAKASILHEVRPVTSGCFPIMHD RTKIRQLPNLLRGYENIRLSTQNVIDAEKAPGGPYRLGTSGSCPNATSKI GFFATMAWAVPKDNYKNATNPLTVEVPYICTEGEDQITVWGFHSDNKTQM KSLYGDSNPQKFTSSANGVTTHYVSQIGDFPDQTEDGGLPQSGRIVVDYM MQKPGKTGTIVYQRGVLLPQKVWCASGRSKVIKGSLPLIGEADCLHEKYG GLNKSKPYYTGEHAKAIGNCPIWVKTPLKLANGTKYRPPAKLLKERGFFG AIAGFLEGGWEGMIAGWHGYTSHGAHGVAVAADLKSTQEAINKITKNLNS LSELEVKNLQRLSGAMDELHNEILELDEKVDDLRADTISSQIELAVLLSN EGIINSEDEHLLALERKLKKMLGPSAVDIGNGCFETKHKCNQTCLDRIAA GTFNAGEFSLPTFDSLNITAASLNDDGLDNH
    • Predicted molecular weight

      58 kDa
    • Amino acids

      16 to 546
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Influenza B Virus Hemagglutinin (B/Wisconsin/01/2010) protein (Genebank No. JN993010).

Specifications

Our Abpromise guarantee covers the use of ab217658 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (up to 6 months). Store at -20°C long term. Avoid freeze / thaw cycle.

    Constituents: 74% PBS, 0.1% BSA, 25% Glycerol

General Info

  • Alternative names

    • HA
    • Hemagglutinin
    • Hemagglutinin HA1 chain
    • Hemagglutinin HA2 chain
  • Relevance

    The influenza viruses are divided into 3 distinct immunological types (A, B, and C ) based upon their nucleocapsid and M protein antigens. Influenza A viruses also occur in pigs, birds, and horses. However, only man is infected by influenza B and C. Influenza type A viruses are divided into subtypes based on two proteins on the surface of the virus. These proteins are called hemagglutinin (HA) and neuraminidase (NA). There are 15 different hemagglutinin subtypes and 9 different neuraminidase subtypes so many different combinations are possible. The antigenic differences of the haemagglutinin and the neuraminidase antigens of influenza A viruses provide the basis of their classification into subtypes. eg. A/Hong Kong/1/68 (H3N2) signifies an influenza A virus isolated from a patient in Hong Kong in 1968, and of subtype H3N2. Influenza B virus is not divided into subtypes based on HA and NA.
  • Cellular localization

    Host cell membrane, Host membrane, Membrane, Viral envelope protein, Virion

Images

  • SDS-PAGE analysis of ab217658.

References

ab217658 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217658.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up