Description

  • Product name

    Recombinant Influenza B Virus Nucleoprotein (Tagged)
    See all Influenza B Virus Nucleoprotein proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Influenza B
    • Sequence

      MSNMDIDGINTGTIDKTPEEIISGTSGATRPIIRPATLAPPSNKRTRNPS PERATTSSEADVGRKTQKKQTPTEIKKSVYNMVVKLGEFYNQMMVKAGLN DDMERNLIQNAHAVERILLAATDDKKTEFQKKKNARDVKEGKEEIDHNKT GGTFYKMVRDDKTIYFSPIRITFLKEEVKTMYKTTMGSDGFSGLNHIMIG HSQMNDVCFQRSKALKRVGLDPSLISTFAGSTLPRRSGATGVAIKGGGTL VAEAIRFIGRAMADRGLLRDIKAKTAYEKILLNLKNKCSAPQQKALVDQV IGSRNPGIADIEDLTLLARSMVVVRPSVASKVVLPISIYAKIPQLGFNVE EYSMVGYEAMALYNMATPVSILRMGDDAKDKSQLFFMSCFGAAYEDLRVL SALTGTEFKPRSALKCKGFHVPAKEQVEGMGAALMSIKLQFWAPMTRSGG NEVGGDGGSGQISCSPVFAVERPIALSKQAVRRMLSMNIEGRDADVKGNL LKMMNDSMAKKTNGNAFIGKKMFQISDKNKTNPVEIPIKQTIPNFFFGRD TAEDYDDLDY
    • Predicted molecular weight

      78 kDa including tags
    • Amino acids

      1 to 560
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Influenza B virus (strain B/Singapore/222/1979). 6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab225599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Influenza B Virus NP
    • NP
    • Nucleocapsid protein
    • Nucleoprotein
    • Protein N
    see all
  • Relevance

    Influenza virus B is a genus in the virus family Orthomyxoviridae. A limited host range means that Influenza virus B pandemics are rare. The nucleoprotein protects the negative strand viral RNA from nucleases by encapsidating it. encapsidated genomic RNA is termed the ribonucleoprotein (RNP) and serves as template for transcription and replication.
  • Cellular localization

    Nuclear

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225599 with 5% enrichment gel and 15% separation gel.

References

ab225599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up