Recombinant Invasin protein (His tag) (ab224847)

Description

  • Product name

    Recombinant Invasin protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Yersinia enterocolitica
    • Sequence

      VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDN QGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSV EASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGN YWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      651 to 835
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Yersinia enterocolitica protein with 6xHis-SUMO tag at the N-terminus.

Specifications

Our Abpromise guarantee covers the use of ab224847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Relevance

    Invasin is a protein that allows enteric bacteria to penetrate cultured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins.
  • Cellular localization

    Cell outer membrane

Images

  •  Discontinuous SDS-PAGE (Tris-Glycine gel) (reduced) analysis of ab224847 with 5% enrichment gel and 15% separation gel.

References

ab224847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up