Description

  • Product name

    Recombinant IpaD protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Shigella flexneri
    • Sequence

      MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDT LHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILS RNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYL KVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALE ELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINM TPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQK YSNANSIFDNLVKVLSSTISSCTDTDKLFLHF
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      1 to 332
    • Tags

      His tag N-Terminus
    • Additional sequence information

      10xHis-SUMO tag at the N-terminus and Myc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab226287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Invasin ipaD
    • secreted by the Mxi-Spa machinery, required for entry of bacteria into epithelial cells
  • Relevance

    Required for bacterial invasion of host cells. Controls ipaB and ipaC secretion, and the efficiency with which they are physically inserted into target cell membranes. These proteins are exported via TTSS to form a pore in the host membrane that allows the translocation of the other effectors into the host cytoplasm. Along with ipaB, is essential for both blocking secretion through the Mxi/Spa translocon in the absence of a secretion-inducing signal, and for controlling the level of secretion in the presence of this signal.
  • Cellular localization

    Secreted

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226287 with 5% enrichment gel and 15% separation gel.

References

ab226287 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up