Description

  • Product name

    Recombinant Japanese encephalitis virus NS1 glycoprotein (His tag)
  • Purity

    > 95 % SDS-PAGE.
    ab218555 was 0.2 um filter sterilised.
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Japanese encephalitis virus
    • Sequence

      DTGCAIDITRKEMRCGSGIFVHNDVEAWVDRYKYLPETPRSLAKIVHKAH KEGVCGVRSVTRLEHQMWEAVRDELNVLLKENAVDLSVVVNKPVGRYRSA PKRLSMTQEKFEMGWKAWGKSILFAPELANSTFVVDGPETKECPDEHRAW NSMQIEDFGFGITSTRVWLKIREESTDECDGAIIGTAVKGHVAVHSDLSY WIESRYNDTWKLERAVFGEVKSCTWPETHTLWGDDVEESELIIPHTIAGP KSKHNRREGYKTQNQGPWDENGIVLDFDYCPGTKVTITEDCSKRGPSVRT TTDSGKLITDWCCRSCSLPPLRFRTENGCWYGMEIRPVMHDETTLVRSQV DA
    • Predicted molecular weight

      40 kDa
    • Amino acids

      795 to 1146
    • Tags

      His tag C-Terminus
    • Additional sequence information

      SA-14 strain. ab218555 is presented in 2 distinct oligomeric states with molecular weights of 335 kDa and 450 kDa, as determined by size exclusion chromatography,
  • Description

    Recombinant Japanese encephalitis virus Japanese encephalitis virus NS1 glycoprotein (His tag)

Specifications

Our Abpromise guarantee covers the use of ab218555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    The antigen is in its native folding state, and possesses all post-translational modifications. Unlike other flavivirus NS1 proteins which secrete as a single hexameric form, Japanese Encephalitis virus NS1 shows two oligomeric states in approximately equal proportion.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    (Dulbecco’s PBS).

General Info

  • Alternative names

    • Japanese encephalitis non-structural protein 1
    • Japanese encephalitis NS1
    • Japanese encephalitis virus non-structural protein 1
  • Relevance

    The Japanese encephalitis viral genome encodes 7 non-structural proteins NS1-NS5. NS1 contains N-linked carbohydrate chains at positions 130 and 207. It is not incorporated into the virion but exists in the host cell, on the cell surface and can also be extracellular.

References

ab218555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up