Recombinant Lipoate-protein ligase A (Tagged) (ab237793)

Description

  • Product name

    Recombinant Lipoate-protein ligase A (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MSTLRLLISDSYDPWFNLAVEECIFRQMPATQRVLFLWRNADTVVIGRAQ NPWKECNTRRMEEDNVRLARRSSGGGAVFHDLGNTCFTFMAGKPEYDKTI STSIVLNALNALGVSAEASGRNDLVVKTVEGDRKVSGSAYRETKDRGFHH GTLLLNADLSRLANYLNPDKKKLAAKGITSVRSRVTNLTELLPGITHEQV CEAITEAFFAHYGERVEAEIISPNKTPDLPNFAETFARQSSWEWNFGQAP AFSHLLDERFTWGGVELHFDVEKGHITRAQVFTDSLNPAPLEALAGRLQG CLYRADMLQQECEALLVDFPEQEKELRELSAWMAGAVR
    • Amino acids

      1 to 338
    • Additional sequence information

      Escherichia coli (strain K12 / MC4100 / BW2952 N-terminal 6xHis-SUMO-tagged

Specifications

Our Abpromise guarantee covers the use of ab237793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Relevance

    Function: Catalyzes both the ATP-dependent activation of exogenously supplied lipoate to lipoyl-AMP and the transfer of the activated lipoyl onto the lipoyl domains of lipoate-dependent enzymes.

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel of ab237793.

References

ab237793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up