Recombinant Lysyl endopeptidase protein (Tagged) (ab241229)

Description

  • Product name

    Recombinant Lysyl endopeptidase protein (Tagged)
    See all Lysyl endopeptidase proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      GVSGSCNIDVVCPEGNGHRDVIRSVAAYSKQGTMWCTGSLVNNSANDKKM YFLTANHCGMTTAAIASSMVVYWNYQNSTCRAPGSSSSGANGDGSLAQSQ TGAVVRATNAASDFTLLELNTAANPAYNLFWAGWDRRDQNFAGATAIHHP NVAEKRISHSTVATEISGYNGATGTSHLHVFWQASGGVTEPGSSGSPIYS PEKRVLGQLHGGPSSCSATGADRSDYYGRVFTSWTGGGTSATRLSDWLDA AGTGAQFIDGLDSTGTPPV
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      1 to 269
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Lysobacter enzymogenes. N-terminal 6xHis-SUMOSTAR-tag.

Specifications

Our Abpromise guarantee covers the use of ab241229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab241229.

References

ab241229 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab241229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up