Description

  • Product name

    Recombinant mCherry protein (His tag)
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Anaplasma marginale
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGH EFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKH PADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLR GTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDA EVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGG MDELYK
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      1 to 236
    • Tags

      His tag N-Terminus
    • Additional sequence information

      pI: 6.23. Ex.= 587 nm (540-590 nm); Em.= 610 nm (550-650 nm).

Specifications

Our Abpromise guarantee covers the use of ab199750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    mCherry is the second generation monomeric red fluorescent protein that has improved brightness and photostability. The protein is suitable as a positive control for mCherry protein expression studies or as a labeling reagent. The recombinant mCherry protein is ideal for fusion tag applications and is perfect for triple labeling with EGFP, CFP, YFP, or any other dyes. The protein is engineered with 6xHis-tag on the N-terminus, which can be used for detection with anti-His-Tag antibody or protein purification/removal by using Ni++ beads.

     

    Endotoxin level: <0.1 ng/µg

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Reconstitute with dH2O to 1 mg/ml. Aliquot and store at -80°C for long-term storage. Avoid freeze thaw cycles.

General Info

  • Relevance

    mCherry is derived from proteins originally isolated from Cnidarians (jelly fish, sea anemones and corals), and is used as a fluorescent tracer in trasfection and transgenic experiments. The prototype for these fluorescent proteins is Green Fluorescent Protein (GFP), which is a ~27kDa protein isolated originally from the jellyfish Aequoria victoria. The mCherry protein is derived from DsRed, a red fluorescent protein related to GFP isolated from so-called disc corals of the genus Discosoma.

References

ab199750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Dot blot
Recombinant mCherry protein was used as standard series for Dot blot. Therefore 2µl sample (protein fused with mCherry) and different dilutions of mCherry protein were blotted on a nitrocellulose membrane (0.45µm, Ultra Cruz) and fluorescence signal detected using a ChemiDocTM MP Imager system (Bio Rad, Austria).

Result: Recombinant mCherry protein (ab199750) is detectable via Dot blot.

Abcam user community

Verified customer

Submitted Aug 23 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up