For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Explore the power of knock-out cell lines for your research

  1. Link

    recombinant-measles-virus-priorix-schwarz-strain-nucleocapsid-protein-ab74559.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Microbiology Organism Virus RNA Virus single stranded RNA negative strand virus Mumps
Share by email

Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)

  • Datasheet
  • SDS
Submit a review Q&A (1)References (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
  • Western blot - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
  • Western blot - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
  • SDS-PAGE - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)

Key features and details

  • Expression system: Saccharomyces cerevisiae
  • Purity: > 95% SDS-PAGE
  • Suitable for: WB, ELISA, SDS-PAGE

Description

  • Product name

    Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein
  • Purity

    > 95 % SDS-PAGE.
    ab74559 is purified by ultracentifugation.
  • Expression system

    Saccharomyces cerevisiae
  • Accession

    AAF85699.1
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSR LLDRLVRLIGNPDVSGPKLTGALIGILSLFVESPGQLIQRITDDPDVSIR LLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSDQSRFGWFGNK EISDIEVQDPEGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYT QQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDIKRTPGNKPRI AEMICDIDTYIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTLESLM NLYQQMGETAPYMVILENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGL NFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDARLVSEIAMH TTEDKISRAVGPRQAQVSFLHGDQSENELPRLGGKEDRRVKQSRGEARES YRETGPSRASDARAAHLPTGTPLDIDTATESSQDPQDSRRSADALLRLQA MAGISEEQGSDTDTPIVYNDRNLLD
    • Predicted molecular weight

      58 kDa
    • Amino acids

      1 to 525

Specifications

Our Abpromise guarantee covers the use of ab74559 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Constituent: PBS

  • Reconstitution
    Lyophilised, reconstitute with 120µl deionised water and add glycerol to 50%

General Info

  • Alternative names

    • N
  • Relevance

    Priorix is a new investigational measles, mumps and rubella (MMR) vaccine containing the Schwarz measles strain, the RA 27/3 rubella strain and a new mumps strain RIT 4385.

Images

  • Western blot - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
    Western blot - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
    All lanes : Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)

    Lanes 1-2 : S. cerevisiae cell lysates without measles nucleoprotein (negative controls)
    Lane 3 : S. cerevisiae cell lysate with recombinantly expressed measles nucleoprotein
    Lane 4 : CsCl purified measles Nucleoprotein from S. cerevisiae

    Predicted band size: 60 kDa

  • Western blot - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
    Western blot - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
    All lanes : Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)

    Lanes 1-2 : S. cerevisiae cell lysates without measles nucleoprotein (negative controls)
    Lane 3 : S. cerevisiae cell lysate with recombinantly expressed measles nucleoprotein
    Lane 4 : CsCl purified measles Nucleoprotein from S. cerevisiae

    Predicted band size: 60 kDa



    SDS-PAGE and WB of yeast lysates and purified Measles Nucleoprotein (ab74559) on a 12% polyacrylamide gel. Immunoblot using measles positive human serum.

  • Western blot - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
    Western blot - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
    All lanes : Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)

    Lanes 1-2 : S. cerevisiae cell lysates without measles nucleoprotein (negative controls)
    Lane 3 : S. cerevisiae cell lysate with recombinantly expressed measles nucleoprotein
    Lane 4 : CsCl purified measles Nucleoprotein from S. cerevisiae

    Predicted band size: 60 kDa



    SDS-PAGE and WB of yeast lysates and purified Measles Nucleoprotein (ab74559) on a 12% polyacrylamide gel.

    Immunoblot using Mab against measles nucleoprotein

  • SDS-PAGE - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
    SDS-PAGE - Recombinant Measles virus Priorix, Schwarz strain, nucleocapsid protein (ab74559)
    SDS-PAGE showing ab74559 at approximately 60kDa. (2 μg/lane).

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • SDS download

  • Datasheet download

    Download

References (3)

Publishing research using ab74559? Please let us know so that we can cite the reference in this datasheet.

ab74559 has been referenced in 3 publications.

  • Böröcz K  et al. Application of a fast and cost-effective 'three-in-one' MMR ELISA as a tool for surveying anti-MMR humoral immunity: the Hungarian experience. Epidemiol Infect 148:e17 (2020). PubMed: 32014073
  • Hong J  et al. Correlation between the results of two analytical methods for measuring measles virus neutralizing antibodies in source plasma and therapeutic immunoglobulin products. Biologicals 59:20-28 (2019). PubMed: 30992162
  • Richardson SI  et al. IgG3 enhances neutralization potency and Fc effector function of an HIV V2-specific broadly neutralizing antibody. PLoS Pathog 15:e1008064 (2019). PubMed: 31841557

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

Question

Could you please send me the MSDS for product
ab74559.
Thank you very much for your kind support.
Regards

Read More

Abcam community

Verified customer

Asked on Mar 15 2013

Answer

Thank you for contacting us.

The MSDS has been created and published. It can now be downloaded from the website.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Abcam Scientific Support

Answered on Mar 15 2013

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2022 Abcam plc. All rights reserved.