Recombinant Mite group 2 allergen Der p 2 protein (His tag) (ab225970)

Description

  • Product name

    Recombinant Mite group 2 allergen Der p 2 protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      European house dust mite
    • Sequence

      DQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNTKTA KIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPK SENVVVTVKVMGDDGVLACAIATHAKIRD
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      18 to 146
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Dermatophagoides pteronyssinus (European house dust mite). This product is the mature full length protein from aa 18 to 146. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab225970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Allergen Der p II
    • Allergen: Der p 2
    • DERP2
    • DPX
  • Cellular localization

    Secreted

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225970 with 5% enrichment gel and 15% separation gel.

References

ab225970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up