Description

  • Product name

    Recombinant Mouse 2B4 protein (His tag)
    See all 2B4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QDCPDSSEEVVGVSGKPVQLRPSNIQTKDVSVQWKKTEQGSHRKIEILNW YNDGPSWSNVSFSDIYGFDYGDFALSIKSAKLQDSGHYLLEITNTGGKVC NKNFQLLILDHVETPNLKAQWKPWTNGTCQLFLSCLVTKDDNVSYALYRG STLISNQRNSTHWENQIDASSLHTYTCNVSNRASWANHTLNFTHGCQSVP SNHHHHHH
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      20 to 221
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab217565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Always centrifuge tubes before opening. Do not mix by vortex or pipetting.

General Info

  • Alternative names

    • 2B4
    • C9.1
    • CD244
    • CD244 antigen
    • CD244 molecule
    • CD244 molecule natural killer cell receptor 2B4
    • CD244 natural killer cell receptor 2B4
    • CD244_HUMAN
    • F730046O15Rik
    • h2B4
    • Ly90
    • NAIL
    • Natural killer cell activation-inducing ligand
    • Natural killer cell receptor 2B4
    • NK cell activation inducing ligand
    • NK cell activation inducing ligand NAIL
    • NK cell activation-inducing ligand
    • NK cell type I receptor protein 2B4
    • NKR2B4
    • Nmrk
    • Non-MHC restricted killing associated
    • OTTHUMP00000027884
    • p38
    • signaling lymphocytic activation molecule 4
    • SLAM family, member 4
    • SLAMF4
    see all
  • Function

    Modulate other receptor-ligand interactions to enhance leukocyte activation.
  • Tissue specificity

    Expressed in spleen, PBL, followed by lung, liver, testis and small intestine. Expressed not only in NK cells, but also on monocytes and basophils.
  • Sequence similarities

    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab217565 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up