Description

  • Product name

    Recombinant mouse 4-1BBL protein (Fc Chimera)
    See all 4-1BBL proteins and peptides
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVV DVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWM SGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVT LTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEK KNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGKSGRTEPRPALTITTSPN LGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHS QDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQ GWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHR LSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
    • Amino acids

      105 to 309
    • Additional sequence information

      Mouse Ig-Fc amino acid sequences are in Italics. Linker sequence (SGR) shown in bold. Mouse CD137L sequences are underlined.

Specifications

Our Abpromise guarantee covers the use of ab72988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: PBS, pH 7.2

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 4 1BB L
    • 4 1BB ligand
    • 4 1BBL
    • 4-1BB ligand
    • 4-1BBL
    • Cd137l
    • Cd157l
    • Homolog of mouse 4 1BB L
    • Homolog of mouse 4 1BBL
    • ILA ligand (TNF related)
    • Ly63l
    • Receptor 4 1BB ligand
    • TNF superfamily member 9
    • TNFL9_HUMAN
    • Tnfsf9
    • TNLG5A
    • Tumor necrosis factor (ligand) superfamily member 9
    • Tumor necrosis factor ligand 5A
    • Tumor necrosis factor ligand superfamily member 9
    • Tumor necrosis factor superfamily member 9
    see all
  • Function

    Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
  • Tissue specificity

    Expressed in brain, placenta, lung, skeletal muscle and kidney.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab72988 electrophoretic analysis by SDS-PAGE. Coomassie Blue stained 4-20% reducing SDS-PAGE.

References

ab72988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab72988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up