Recombinant mouse 4-1BBL protein (Fc Chimera Active) (ab220539)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: Fc tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant mouse 4-1BBL protein (Fc Chimera Active)
See all 4-1BBL proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse 4-1BB, His Tag at 0.5 μg/mL (100 µL/well), can bind ab220539 with a linear range of 0.4-6 ng/mL.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
RTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLA KNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLE LKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLV DRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVK PDNPWE -
Predicted molecular weight
49 kDa including tags -
Amino acids
104 to 309 -
Tags
Fc tag C-Terminus -
Additional sequence information
This protein carries a human IgG1 Fc tag at the C-terminus.
-
Specifications
Our Abpromise guarantee covers the use of ab220539 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
• -20°C to -70°C for 12 months in lyophilized state;
• -70°C for 3 months under sterile conditions after reconstitution. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, Sodium chloride, L-Arginine
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 100 µg/ml.
General Info
-
Alternative names
- 4 1BB L
- 4 1BB ligand
- 4 1BBL
see all -
Function
Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. -
Tissue specificity
Expressed in brain, placenta, lung, skeletal muscle and kidney. -
Sequence similarities
Belongs to the tumor necrosis factor family. -
Cellular localization
Membrane. - Information by UniProt
Images
-
Immobilized Mouse 4-1BB, His Tag at 0.5 μg/mL (100 μL/well) can bind Mouse 4-1BBL protein (Fc Chmera Active) (ab220539) with a linear range of 0.4-6 ng/mL.
-
Mouse 4-1BBL protein (Fc Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue.
The protein migrates as 64-80 kDa under reducing conditions due to glycosylation.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab220539 has not yet been referenced specifically in any publications.