Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      RTEPRPALTITTSPNLGTRENNADQVTPVSHIGCPNTTQQGSPVFAKLLA KNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLYYVFLE LKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLV DRSWSQLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVK PDNPWE
    • Molecular weight

      49 kDa including tags
    • Amino acids

      104 to 309
    • Tags

      Fc tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab220539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Immobilized Mouse 4-1BB, His Tag  at 0.5 μg/mL (100 µL/well), can bind ab220539 with a linear range of 0.1-3 ng/mL.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, Sodium chloride, L-Arginine

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 4 1BB L
    • 4 1BB ligand
    • 4 1BBL
    • 4-1BB ligand
    • 4-1BBL
    • Cd137l
    • Cd157l
    • Homolog of mouse 4 1BB L
    • Homolog of mouse 4 1BBL
    • ILA ligand (TNF related)
    • Ly63l
    • Receptor 4 1BB ligand
    • TNF superfamily member 9
    • TNFL9_HUMAN
    • Tnfsf9
    • TNLG5A
    • Tumor necrosis factor (ligand) superfamily member 9
    • Tumor necrosis factor ligand 5A
    • Tumor necrosis factor ligand superfamily member 9
    • Tumor necrosis factor superfamily member 9
    see all
  • Function

    Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
  • Tissue specificity

    Expressed in brain, placenta, lung, skeletal muscle and kidney.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Mouse 4?1BB Ligand (Fc Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • SDS-PAGE analysis of ab220539 under reducing conditions, stained overnight with Coomassie Blue. As a result of glycosylation, the reduced protein migrates as 60-70 kDa.

  • Immobilized Mouse 4-1BB, His Tag  at 0.5 μg/mL (100 µL/well), can bind ab220539 with a linear range of 0.1-3 ng/mL.

References

ab220539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up