Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      HHHHHHHHHHGGGSGGGSGGGSIEGRRTEPRPALTITTSPNLGTRENNAD QVTPVSHIGCPNTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYL SQGLRYEEDKKELVVDSPGLYYVFLELKLSPTFTNTGHKVQGWVSLVLQA KPQVDDFDNLALTVELFPCSMENKLVDRSWSQLLLLKAGHRLSVGLRAYL HGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE
    • Molecular weight

      226 kDa including tags
    • Amino acids

      104 to 309
    • Tags

      His tag N-Terminus
    • Additional sequence information

      extracellular domain

Specifications

Our Abpromise guarantee covers the use of ab215658 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Reconstitute with ddH2O to a concentration no less than 100 µg/mL. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • 4 1BB L
    • 4 1BB ligand
    • 4 1BBL
    • 4-1BB ligand
    • 4-1BBL
    • Cd137l
    • Cd157l
    • Homolog of mouse 4 1BB L
    • Homolog of mouse 4 1BBL
    • ILA ligand (TNF related)
    • Ly63l
    • Receptor 4 1BB ligand
    • TNF superfamily member 9
    • TNFL9_HUMAN
    • Tnfsf9
    • TNLG5A
    • Tumor necrosis factor (ligand) superfamily member 9
    • Tumor necrosis factor ligand 5A
    • Tumor necrosis factor ligand superfamily member 9
    • Tumor necrosis factor superfamily member 9
    see all
  • Function

    Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
  • Tissue specificity

    Expressed in brain, placenta, lung, skeletal muscle and kidney.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab215658 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215658.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up