Description

  • Product name

    Recombinant Mouse ACY-1 protein
    See all ACY-1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab201904 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEFMTTKDPESEHPSVTLFRQYLRICTV QPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSI LLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAV RRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDE GLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISS ILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDF RVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWA AFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDH NERLHEDIFLRGVDIYTGLLSALASVPTLPGES
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      1 to 408
    • Tags

      His tag N-Terminus
    • Additional sequence information

      AAH05631

Specifications

Our Abpromise guarantee covers the use of ab201904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • ACY 1
    • ACY-1
    • Acy1
    • ACY1_HUMAN
    • ACY1D
    • ACYLASE
    • Acylase I
    • Aminoacylase 1
    • Aminoacylase-1
    • EC 3.5.1.14
    • epididymis secretory protein Li 5
    • HEL-S-5
    • N acyl L amino acid amidohydrolase
    • N-acyl-L-amino-acid amidohydrolase
    • OTTHUMP00000212459
    • OTTHUMP00000212462
    • OTTHUMP00000212463
    • OTTHUMP00000212464
    • OTTHUMP00000212465
    see all
  • Function

    Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).
  • Tissue specificity

    Expression is highest in kidney, strong in brain and weaker in placenta and spleen.
  • Involvement in disease

    Defects in ACY1 are the cause of aminoacylase-1 deficiency (ACY1D) [MIM:609924]. ACY1D results in a metabolic disorder manifesting with encephalopathy, unspecific psychomotor delay, psychomotor delay with atrophy of the vermis and syringomyelia, marked muscular hypotonia or normal clinical features. Epileptic seizures are a frequent feature. All affected individuals exhibit markedly increased urinary excretion of several N-acetylated amino acids.
  • Sequence similarities

    Belongs to the peptidase M20A family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab201904 (3µg).

References

ab201904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up