Recombinant Mouse Adiponectin protein (ab157283)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Mouse Adiponectin protein
See all Adiponectin proteins and peptides -
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceHEK 293 cells
-
Amino Acid Sequence
-
Accession
-
SpeciesMouse
-
SequenceEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGE KGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAA
-
Molecular weight25 kDa including tags
-
Amino acids18 to 111
-
TagsDDDDK tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab157283 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Endotoxin level< 0.100 Eu/µg
-
Purity>90% by SDS-PAGE.
-
FormLyophilised
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20ºC.
Constituent: 99% PBS
-
ReconstitutionReconstitute with 100µl sterile water to a final concentration of 0.1 mg/ml. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
General Info
-
Alternative names
- 30 kDa adipocyte complement related protein
- 30 kDa adipocyte complement-related protein
- ACDC
see all -
FunctionImportant adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
-
Tissue specificitySynthesized exclusively by adipocytes and secreted into plasma.
-
Involvement in diseaseDefects in ADIPOQ are the cause of adiponectin deficiency (ADPND) [MIM:612556]. ADPND results in very low concentrations of plasma adiponectin.
Genetic variations in ADIPOQ are associated with non-insulin-dependent diabetes mellitus (NIDDM) [MIM:125853]; also known as diabetes mellitus type 2. NIDDM is characterized by an autosomal dominant mode of inheritance, onset during adulthood and insulin resistance. -
Sequence similaritiesContains 1 C1q domain.
Contains 1 collagen-like domain. -
DomainThe C1q domain is commonly called the globular domain.
-
Post-translational
modificationsHydroxylated Lys-33 was not identified in PubMed:16497731, probably due to poor representation of the N-terminal peptide in mass fingerprinting.
HMW complexes are more extensively glycosylated than smaller oligomers. Hydroxylation and glycosylation of the lysine residues within the collagene-like domain of adiponectin seem to be critically involved in regulating the formation and/or secretion of HMW complexes and consequently contribute to the insulin-sensitizing activity of adiponectin in hepatocytes.
O-glycosylated. Not N-glycosylated. O-linked glycans on hydroxylysines consist of Glc-Gal disaccharides bound to the oxygen atom of post-translationally added hydroxyl groups. Sialylated to varying degrees depending on tissue. Thr-22 appears to be the major site of sialylation. Higher sialylation found in SGBS adipocytes than in HEK fibroblasts. Sialylation is not required neither for heterodimerization nor for secretion. Not sialylated on the glycosylated hydroxylysines. Desialylated forms are rapidly cleared from the circulation. -
Cellular localizationSecreted.
- Information by UniProt
Images
-
ab157283 does not bind to rhTNF-R1 and rhOX40:Fc in an ELISA assay.
Method: A 96 well ELISA plate was coated O/N at RT with 100 µl of 1 µg/ml rhTNF-R1:Fc and 1 µg/ml rhOX40:Fc in PBS. 100 µl of ab157283 at 8 µg/ml were mixed with 100 µl 0.5% FCS in PBS in the first well and a series of 1:1 dilutions was prepared for the following wells. Binding of ab157283 to the receptor:Fc was detected after 1 hr incubation at 37°C using a goat anti-human HRP conjugated antibody (1/1000 dilution, 1 hr incubation). O-phenylenediamine dihydrochloride (OPD) was used as a substrate, and absorbance was measured at 490 nm in an ELISA reader.
Datasheets and documents
References
ab157283 has not yet been referenced specifically in any publications.