Description

  • Product name

    Recombinant Mouse AER61 protein (His tag)
  • Purity

    > 85 % SDS-PAGE.
    ab219239 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      DKAHSEADDAPGKALYDYSSLRLPAEHIPFFLHNNRHVASVCREDSHCPY KKHLENLNYCWGYEKSCAPEFRFGSPVCSYVDLGWTDTLESAQDMFWRQA DFGYARERLGEIRTICQPERASDSSLVCSRYLQYCRATGLYLDLRNIKRN HDRFKEDFLQGGEIGGYCKLDSHALVSEGQRKSPLQSWFAELQGYTQLNF RPIEDAKCDIVVEKPTYFMKLDAGINMYHHFCDFLNLYLTQHVNNSFSTD VYIVMWDTSTYGYGDLFSDTWKAFTDYDVIHLKTYDSKKVCFKEAVFSLL PRMRYGLFYNTPLISGCQNTGLFRAFSQHVLHRLNITQEGPKDGKVRVTI LARSTEYRKILNQDELVNALKTVSTFEVRVVDYKYRELGFLDQLRITHNT DIFIGMHGAGLTHLLFLPDWAAVFELYNCEDERCYLDLARLRGIHYITWR KPSKVFPQDKGHHPTLGEHPKFTNYSFDVEEFMYLVLQAAEHVLQHPQWP FKKKHDELLEHHHHHH
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      20 to 527
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 20 to 527. The signal peptide is not included (NP_780522).

Specifications

Our Abpromise guarantee covers the use of ab219239 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • AER61 glycosyltransferase
    • AOS4
    • C3orf64
    • EGF domain specific O linked N acetylglucosamine transferase
    • EGF domain-specific O-linked N-acetylglucosamine transferase
    • EGF O GlcNAc transferase
    • EGF-O-GlcNAc transferase
    • EOGT
    • EOGT_HUMAN
    • EOGT1
    • Extracellular O-linked N-acetylglucosamine transferase
    • Uncharacterized glycosyltransferase AER61
    see all
  • Relevance

    Function: Catalyzes the transfer of a single N-acetylglucosamine from UDP-GlcNAc to a serine or threonine residue in extracellular proteins resulting in their modification with a beta-linked N-acetylglucosamine (O-GlcNAc). Specifically glycosylates the Thr residue located between the fifth and sixth conserved cysteines of folded EGF-like domains. Disease: Adams-Oliver syndrome 4 Similarity: Belongs to the glycosyltransferase 61 family.
  • Cellular localization

    Secreted

Images

  • 15% SDS-PAGE analysis of 3 μg ab219239.

    Molecular weight: 50-70 kDa (SDS-PAGE under reducing conditions).

References

ab219239 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219239.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up