Recombinant Mouse AHSA2 protein (His tag) (ab222788)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGHHHHHHMAKWGQGDPRWIVEEREDGTNVNNWHWTERDATIWSKGKLRE LLVGIAMENEAGRCEISELKQVEGEASCNSRKGKLIFFYEWNIKLAWKGT VKESGAKHKGLIEIPSLSEENEINDTEVNVSKKKGDGEILKDLMRTTGTA KVREALGEYLKALKTEFTTGMILPTKAVATQELTLQRKLNENKLQASPVA LGVRIPTVALHLTELFDTTVEQLYSIFTVKELVQKFSKSPAVLEAERGGK FQMFDGNISGEYVELVTNRKIIMKWRCRNWPEEHYATVELNFVPAPGQTE LQLDCKGVPVCKEENMKFCWQKQHFEEIKGLLELTAQNA
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1 to 331
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab222788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    Affinity purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 0.3% Tris, 0.87% Sodium chloride, 0.02% DTT, 50% Glycerol

General Info

  • Alternative names

    • Activator of 90 kDa heat shock protein ATPase homolog 2
    • AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast)
    • Ahsa2
    • AHSA2_HUMAN
    • Hch1
    see all
  • Function

    Co-chaperone that stimulates HSP90 ATPase activity.
  • Sequence similarities

    Belongs to the AHA1 family.
  • Information by UniProt

References

ab222788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up