Description

  • Product name

    Recombinant Mouse AHSG protein
    See all AHSG proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab201896 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      APQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKV WSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHI LKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTAL AAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAK CNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTA NAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETL HSPKVGQPGAAGPVSPMCPGRIRHFKIHHHHHH
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      19 to 345
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab201896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • 59 kDa bone sialic acid-containing protein
    • A2HS
    • Aa2-066
    • AHS
    • Ahsg
    • Ahsg alpha-2-HS-glycoprotein
    • Alpha 2 HS Glycoprotein
    • Alpha 2 Z globulin
    • Alpha-2-HS-glycoprotein
    • Alpha-2-HS-glycoprotein chain B
    • Alpha-2-Z-globulin
    • Asialofetuin
    • Ba alpha 2 glycoprotein
    • Ba-alpha-2-glycoprotein
    • BSP
    • Countertrypin
    • Fetua
    • FETUA_HUMAN
    • Fetuin , mouse, homolog of
    • Fetuin A
    • Fetuin-A
    • Glycoprotein PP63
    • HSGA
    • pp63
    see all
  • Function

    Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions.
  • Tissue specificity

    Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.
  • Sequence similarities

    Belongs to the fetuin family.
    Contains 2 cystatin fetuin-A-type domains.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab201896 (3μg).

    MW: 40-57 KDa (SDS–PAGE under reducing conditions).

References

ab201896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up