Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMGCCVSSEPQEEGGRKTGEKLKKAKII FVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAIM EKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQ PTLLLYVDAGAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVI SFYDKRGIVRKVNAEGTVDTVFSEVCTYLDSLK
    • Molecular weight

      26 kDa including tags
    • Amino acids

      1 to 210
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_067490

Specifications

Our Abpromise guarantee covers the use of ab227415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 150 units/mg. One unit will convert 2.0 µmoles of ADP to ATP + AMP per minute at pH 7.5 at 37°C.

  • Applications

    Functional Studies

    Mass Spectrometry

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab227415 was purified by using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

    Previously labelled as Adenylate Kinase 1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Adenylate kinase 1
    • Adenylate kinase isoenzyme 1
    • Adenylate kinase soluble
    • AK 1
    • Ak1
    • ATP AMP transphosphorylase
    • ATP-AMP transphosphorylase 1
    • KAD1
    • KAD1_HUMAN
    • Myokinase
    see all
  • Function

    Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth.
  • Involvement in disease

    Defects in AK1 are the cause of hemolytic anemia due to adenylate kinase deficiency [MIM:612631].
  • Sequence similarities

    Belongs to the adenylate kinase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg Recombinant mouse AK 1 protein (Active) (ab227415).

     

References

ab227415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up