Overview

Description

  • Nature

    Recombinant
  • Source

    Mammalian
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVP EDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGV HDRVFDVNDKVENSLEPADDTVHESAEPSRGENAAQVDHHHHHH
    • Molecular weight

      23 kDa including tags
    • Amino acids

      21 to 206
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Ephrin A5.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. After reconstitution aliquot and store at < -20°C, avoid freeze/thaw cycles.

General Info

  • Alternative names

    • EPLG7
    • AF1
    • AL 1
    • AL-1
    • EFL5
    • Efna5
    • EFNA5_HUMAN
    • EPH-related receptor tyrosine kinase ligand 7
    • Ephrin A5
    • Ephrin-A5
    • EPLG7
    • GLC1M
    • LERK-7
    • LERK7
    • RAGS
    see all
  • Function

    May function actively to stimulate axon fasciculation. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase.
  • Sequence similarities

    Belongs to the ephrin family.
  • Cellular localization

    Cell membrane. Membrane > caveola. Compartmentalized in discrete caveolae-like membrane microdomains.
  • Information by UniProt

References

ab185830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up