Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMASHLELNNGTKMPTLGLGTWKSPPGQ VTEAVKVAIDLGYRHIDCAQVYQNEKEVGVALQEKLKEQVVKRQDLFIVS KLWCTFHDKSMVKGAFQKTLSDLQLDYLDLYLIHWPTGFKPGPDYFPLDA SGNVIPSDTDFVDTWTAMEQLVDEGLVKTIGVSNFNPLQIERILNKPGLK YKPAVNQIECHPYLTQEKLIEYCHSKGIVVTAYSPLGSPDRPWAKPEDPS LLEDPRIKAIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPVRIAENLKVF DFEVSSEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV
    • Molecular weight

      38 kDa including tags
    • Amino acids

      1 to 316
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_033788

Specifications

Our Abpromise guarantee covers the use of ab202234 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • ADR
    • AKR1B 1
    • Akr1b1
    • Aldehyde reductase
    • Aldehyde reductase 1
    • Aldo keto reductase family 1, member B1
    • Aldo-keto reductase family 1 member B1
    • aldo-keto reductase family 1, member B1 (aldose reductase)
    • Aldose reductase
    • aldr 1
    • ALDR_HUMAN
    • aldr1
    • ALR2
    • AR
    • Lii5 2 CTCL tumor antigen
    • Low Km aldose reductase
    • MGC1804
    see all
  • Function

    Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.
  • Tissue specificity

    Highly expressed in embryonic epithelial cells (EUE) in response to osmotic stress.
  • Sequence similarities

    Belongs to the aldo/keto reductase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202234  (3µg).

References

ab202234 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202234.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up