Bioactive grade

Recombinant mouse Alkaline Phosphatase, Tissue Non-Specific protein (Active) (ab222955)

Description

  • Product name

    Recombinant mouse Alkaline Phosphatase, Tissue Non-Specific protein (Active)
    See all Alkaline Phosphatase, Tissue Non-Specific proteins and peptides
  • Biological activity

    Specific activity is > 46,000 pmol/min/µg and is defined as the amount of enzyme that hydrolyze 1 pmole of 4-Methylumbelliferyl phosphate to phosphate and 4-Methylumbelliferone per minute at pH 8.8 at 25°C. 

  • Purity

    > 95 % SDS-PAGE.
    ab222955 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      VPEKERDPSYWRQQAQETLKNALKLQKLNTNVAKNVIMFLGDGMGVSTVT AARILKGQLHHNTGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYL CGVKANEGTVGVSAATERTRCNTTQGNEVTSILRWAKDAGKSVGIVTTTR VNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIKDIDVI MGGGRKYMYPKNRTDVEYELDEKARGTRLDGLDLISIWKSFKPRHKHSHY VWNRTELLALDPSRVDYLLGLFEPGDMQYELNRNNLTDPSLSEMVEVALR ILTKNLKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDQAIGKAGAMTSQ KDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNG PGYKVVDGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMA HLLHGVHEQNYIPHVMAYASCIGANLDHCAWAGSGLEHHHHHH
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      19 to 503
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_031457.

Specifications

Our Abpromise guarantee covers the use of ab222955 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AKP2
    • Alkaline phosphatase liver/bone/kidney
    • Alkaline phosphatase liver/bone/kidney isozyme
    • Alkaline phosphatase tissue nonspecific isozyme
    • Alkaline phosphatase, tissue-nonspecific isozyme
    • Alkaline phosphomonoesterase
    • Alpl
    • AP TNAP
    • AP-TNAP
    • APTNAP
    • BAP
    • FLJ40094
    • FLJ93059
    • Glycerophosphatase
    • HOPS
    • Liver/bone/kidney type alkaline phosphatase
    • MGC161443
    • MGC167935
    • PHOA
    • PPBT_HUMAN
    • Tissue non specific alkaline phosphatase
    • Tissue nonspecific ALP
    • TNAP
    • TNSALP
    see all
  • Function

    This isozyme may play a role in skeletal mineralization.
  • Involvement in disease

    Hypophosphatasia
    Hypophosphatasia childhood type
    Hypophosphatasia infantile type
  • Sequence similarities

    Belongs to the alkaline phosphatase family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222955.

    MWt 50-70 kDa (SDS-PAGE under reducing conditions) .

References

ab222955 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222955.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up