Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      KALHENEFGIASTLDSSQCVTEKNVLSIATITFTQFVPEATEEEVNKMTS DVLAAMKKNSGDGCLESQLSVFLDEICHETELSNKYGLSGCCSQSGVERH QCLLARKKTAPASVPPFQFPEPAESCKAHEENRAVFMNRFIYEVSRRNPF MYAPAILSLAAQYDKVVLACCKADNKEECFQTKRASIAKELREGSMLNEH VCSVIRKFGSRNLQATTIIKLSQKLTEANFTEIQKLALDVAHIHEECCQG NSLECLQDGEKVMTYICSQQNILSSKIAECCKLPMIQLGFCIIHAENGVK PEGLSLNPSQFLGDRNFAQFSSEEKIMFMASFLHEYSRTHPNLPVSVILR IAKTYQEILEKCSQSGNLPGCQDNLEEELQKHIEESQALSKQSCALYQTL GDYKLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASTCCQLSEEKWSGC GEGMADIFIGHLCIRNEASPVNSGISHCCNSSYSNRRLCITSFLRDETYA PPPFSEDKFIFHKDLCQAQGKALQTMKQELLINLVKQKPELTEEQLAAVT ADFSGLLEKCCKAQDQEVCFTEEGPKLISKTRDALGV
    • Molecular weight

      65 kDa
    • Amino acids

      19 to 605
    • Additional sequence information

      This product is the mature full length protein from aa 19 to 605. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab226406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • Afp
    • AFPD
    • Alpha fetoglobulin
    • Alpha fetoprotein
    • Alpha fetoprotein precursor
    • Alpha-1-fetoprotein
    • Alpha-fetoglobulin
    • Alpha-fetoprotein
    • alpha-fetoprotein, Hereditary persistence of, included
    • FETA
    • FETA_HUMAN
    • Hereditary persistence of alpha fetoprotein
    • HPAFP
    see all
  • Function

    Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties.
  • Tissue specificity

    Plasma. Synthesized by the fetal liver and yolk sac.
  • Sequence similarities

    Belongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Developmental stage

    Occurs in the plasma of fetuses more than 4 weeks old, reaches the highest levels during the 12th-16th week of gestation, and drops to trace amounts after birth. The serum level in adults is usually less than 40 ng/ml. AFP occurs also at high levels in the plasma and ascitic fluid of adults with hepatoma.
  • Post-translational
    modifications

    Independent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence.
    Sulfated.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226406 with 5% enrichment gel and 15% separation gel.

References

ab226406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up