Description

  • Product name

    Recombinant Mouse Alpha B Crystallin protein
    See all Alpha B Crystallin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab74970 is purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLR PPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK QVSGPERTIPITREEKPAVAAAPKK
    • Predicted molecular weight

      20 kDa
    • Amino acids

      1 to 175

Specifications

Our Abpromise guarantee covers the use of ab74970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.242% Tris, 10% Glycerol

General Info

  • Alternative names

    • AACRYA
    • Alpha B crystallin
    • Alpha crystallin B chain
    • Alpha(B)-crystallin
    • Alpha-crystallin B chain
    • CRYA2
    • Cryab
    • CRYAB_HUMAN
    • Crystallin alpha B
    • Crystallin alpha polypeptide 2
    • CTPP2
    • Heat shock 20 kD like protein
    • Heat shock protein beta 5
    • Heat shock protein beta-5
    • HspB5
    • Renal carcinoma antigen NY REN 27
    • Renal carcinoma antigen NY-REN-27
    • Rosenthal fiber component
    see all
  • Function

    May contribute to the transparency and refractive index of the lens.
  • Tissue specificity

    Lens as well as other tissues.
  • Involvement in disease

    Defects in CRYAB are the cause of myofibrillar alpha-B crystallin-related (MFM-CRYAB) [MIM:608810]. A neuromuscular disorder that results in weakness of the proximal and distal limb muscles, weakness of the neck, velopharynx and trunk muscles, hypetrophic cardiomyopathy, and cataract in a subset of patients.
  • Sequence similarities

    Belongs to the small heat shock protein (HSP20) family.
  • Cellular localization

    Cytoplasm. Nucleus. Translocates to the nucleus during heat shock and resides in sub-nuclear structures known as SC35 speckles or nuclear splicing speckles.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab74970 at approximately 20kDa. (3µg)

References

ab74970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab74970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up