Description

  • Product name

    Recombinant Mouse AMH protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYG NHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVA TEC
    • Predicted molecular weight

      11 kDa
    • Amino acids

      450 to 552

Specifications

Our Abpromise guarantee covers the use of ab235617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Anti muellerian hormone
    • MIF
    • MIS
    • Muellerian inhibiting factor
    • Mullerian inhibiting substance
    see all
  • Relevance

    Anti mullerian hormone (AMH) is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. Originally classified as a foetal testicular hormone that inhibits Mullerian duct development, AMH is expressed post natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.
  • Cellular localization

    Secreted

Images

  • ab235617 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235617 indicates that this peptide derived from E.coli-expressed Mus musculus (Mouse) Amh.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235617 indicates that this peptide derived from E.coli-expressed Mus musculus (Mouse) Amh.

References

ab235617 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235617.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up