Recombinant Mouse Angiogenin-4 protein (Tagged) (ab238236)

Description

  • Product name

    Recombinant Mouse Angiogenin-4 protein (Tagged)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKK NIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRY IVIACEDGWPVHFDESFISP
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      25 to 144
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged. Full length mature chain without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab238236 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Ang4
    • ANG4_MOUSE
    • Angiogenin-4
  • Function

    Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).
  • Tissue specificity

    Detected in small intestine, caecum and colon, with the highest expression in Paneth cells in the intestinal epithelium.
  • Sequence similarities

    Belongs to the pancreatic ribonuclease family.
  • Cellular localization

    Cytoplasmic vesicle, secretory vesicle lumen. Secreted. Nucleus, nucleolus. Exposure to bacterial lipopolysaccharide (LPS) triggers secretion from intestinal epithelium cells (PubMed:12548285). Rapidly endocytosed by target cells and translocated to the nucleus where it accumulates in the nucleolus and binds to DNA (By similarity).
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab238236.

References

ab238236 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238236.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up