Description

  • Product name

    Recombinant Mouse Annexin A1/ANXA1 protein
    See all Annexin A1/ANXA1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab202184 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAMVSEFLKQARFLENQEQEYVQAVKS YKGGPGSAVSPYPSFNVSSDVAALHKAIMVKGVDEATIIDILTKRTNAQR QQIKAAYLQENGKPLDEVLRKALTGHLEEVVLAMLKTPAQFDADELRGAM KGLGTDEDTLIEILTTRSNEQIREINRVYREELKRDLAKDITSDTSGDFR KALLALAKGDRCQDLSVNQDLADTDARALYEAGERRKGTDVNVFTTILTS RSFPHLRRVFQNYGKYSQHDMNKALDLELKGDIEKCLTTIVKCATSTPAF FAEKLYEAMKGAGTRHKALIRIMVSRSEIDMNEIKVFYQKKYGISLCQAI LDETKGDYEKILVALCGGN
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      1 to 346
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_034860.

Specifications

Our Abpromise guarantee covers the use of ab202184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 20% Glycerol, 0.02% DTT, 79% PBS

General Info

  • Alternative names

    • Annexin 1
    • Annexin A1
    • Annexin I
    • Annexin I (lipocortin I)
    • Annexin-1
    • AnnexinA1
    • AnnexinI
    • ANX 1
    • ANX A1
    • ANX1
    • ANXA 1
    • ANXA1
    • ANXA1 protein
    • ANXA1_HUMAN
    • Calpactin 2
    • Calpactin II
    • Calpactin-2
    • CalpactinII
    • Chromobindin 9
    • Chromobindin-9
    • Chromobindin9
    • HGNC:533
    • Lipocortin 1
    • Lipocortin I
    • Lipocortin1
    • LipocortinI
    • LPC 1
    • LPC1
    • p35
    • Phospholipase A2 inhibitory protein
    see all
  • Function

    Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. This protein regulates phospholipase A2 activity. It seems to bind from two to four calcium ions with high affinity.
  • Sequence similarities

    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain

    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Post-translational
    modifications

    Phosphorylated by protein kinase C, epidermal growth factor receptor/kinase and TRPM7. Phosphorylation results in loss of the inhibitory activity.
  • Cellular localization

    Nucleus. Cytoplasm. Cell projection > cilium. Basolateral cell membrane. Found in the cilium, nucleus and basolateral cell membrane of ciliated cells in the tracheal endothelium (By similarity). Found in the cytoplasm of type II pneumocytes and alveolar macrophages.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202184 (3 μg).

References

ab202184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up