Description

  • Product name

    Recombinant Mouse ANTXR2/CMG-2 protein (His tag)
    See all ANTXR2/CMG-2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab222433 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QAQEQPSCKKAFDLYFVLDKSGSVANNWIEIYNFVHQLTERFVSPEMRLS FIVFSSQATIILPLTGDRYKIGKGLEDLKAVKPVGETYIHEGLKLANEQI QNAGGLKASSIIIALTDGKLDGLVPSYAENEAKKSRSLGASVYCVGVLDF EQAQLERIADSKDQVFPVKGGFQALKGIINSILAQSCTEILELSPSSVCV GEKFQVVLTGRAVTSISHDGSVLCTFTANSTYTKSEKPVSIQPSSILCPA PVLNKDGETLEVSISYNDGKSAVSRSLTITATECTNGLEHHHHHH
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      32 to 318
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_598499).

Specifications

Our Abpromise guarantee covers the use of ab222433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as ANTXR2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • 2310046B19Rik
    • Anthrax toxin receptor 2
    • ANTR2_HUMAN
    • Antxr2
    • AW561899
    • Capillary morphogenesis gene 2 protein
    • Capillary morphogenesis protein 2
    • CMG 2
    • CMG-2
    • CMG2
    • FLJ31074
    • HFS
    • ISH
    • JHF
    • MGC111533
    • MGC45856
    see all
  • Function

    Necessary for cellular interactions with laminin and the extracellular matrix.
  • Tissue specificity

    Expressed in prostate, thymus, ovary, testis, pancreas, colon, heart, kidney, lung, liver, peripheral blood leukocytes, placenta, skeletal muscle, small intestine and spleen.
  • Involvement in disease

    Defects in ANTXR2 are the cause of infantile systemic hyalinosis (ISH) [MIM:236490]. This autosomal recessive syndrome is similar to JHF, but has an earlier onset and a more severe course. Symptoms appear at birth or within the first months of life, with painful, swollen joint contractures, osteopenia, osteoporosis and livid red hyperpigmentation over bony prominences. Patients develop multiple subcutaneous skin tumors and gingival hypertrophy. Hyaline deposits in multiple organs, recurrent infections and intractable diarrhea often lead to death within the first 2 years of life. Surviving children may suffer from severely reduced mobility due to joint contractures.
    Defects in ANTXR2 are the cause of juvenile hyaline fibromatosis (JHF) [MIM:228600]. JHF is an autosomal recessive syndrome that is similar to ISH but takes a milder course. It is characterized by hyaline deposition in the dermis, multiple subcutaneous skin tumors and gingival hypertrophy, followed by progressive joint contractions, osteopenia and osteoporosis that may lead to a severe limitation of mobility.
  • Sequence similarities

    Belongs to the ATR family.
    Contains 1 VWFA domain.
  • Domain

    Binding to PA seems to be effected through the VWA domain.
  • Cellular localization

    Secreted; Cell membrane. Expressed at the cell surface and Endoplasmic reticulum membrane. Expressed predominantly within the endoplasmic reticulum and not at the plasma membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222433.

    MWt 28-40 kDa (SDS-PAGE under reducing conditions).

References

ab222433 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up