Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFL KGYWSKFTDKFTGFWDSNPEDQPTPAIES
    • Molecular weight

      25 kDa including tags
    • Amino acids

      21 to 99
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Full length mature chain without signal peptide. N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab226264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • APOC3
    • APO C3
    • Apo CIII
    • Apo-CIII
    • APOC 3
    • ApoC III
    • ApoC-III
    • APOC3
    • APOC3_HUMAN
    • ApoCIII
    • Apolipoprotein C III
    • Apolipoprotein C-III
    • Apolipoprotein C3
    • ApolipoproteinCIII
    • MGC150353
    see all
  • Function

    Inhibits lipoprotein lipase and hepatic lipase and decreases the uptake of lymph chylomicrons by hepatic cells. This suggests that it delays the catabolism of triglyceride-rich particles.
  • Tissue specificity

    Constitutes 50% of the protein fraction of VLDL and 2% of that of HDL. Synthesized predominantly in liver and to a lesser degree in intestine.
  • Involvement in disease

    Defects in APOC3 may be a cause of hyperalphalipoproteinemia (HYPALIP) [MIM:143470]. Affected individuals show high levels of alpha-lipoprotein (high density lipoprotein/HDL).
  • Sequence similarities

    Belongs to the apolipoprotein C3 family.
  • Post-translational
    modifications

    O-linked glycan consists of Gal-GalNAc disaccharide, further modified with up to 3 sialic acid residues. O-glycosylated on Thr-94 with a core 1 or possibly core 8 glycan.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab226264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up