Recombinant mouse Aspartate Aminotransferase protein (His tag) (ab201889)

Description

  • Product name

    Recombinant mouse Aspartate Aminotransferase protein (His tag)
    See all Aspartate Aminotransferase proteins and peptides
  • Biological activity

    Specific activity is > 80 units/mg, and is defined as the amount of enzyme that converts 1.0 μmole of α-ketoglutarate to L-Glutamate per minute at pH 8.0 at 25°C.

  • Purity

    > 95 % SDS-PAGE.
    ab201889 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMAPPSVFAQVPQAPPVLVFKLTADFRD DPDPRKVNLGVGAYRTDESQPWVLPVVRKVEQKIANDNSLNHEYLPILGL AEFRSCASRLVLGDNSPAIRENRVGGVQSLGGTGALRIGADFLGRWYNGT DNKNTPIYVSSPTWENHNAVFSAAGFKDIRPYCYWDAEKRGLDLQGFLND LENAPEFSIFVLHACAHNPTGTDPTPEQWKQIAAVMQRRFLFPFFDSAYQ GFASGDLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVGKE SDSVLRVLSQMEKIVRITWSNPPAQGARIVAATLSDPELFKEWKGNVKTM ADRILTMRSELRARLEALKTPGTWSHITEQIGMFSFTGLNPKQVEYLVNE KHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKIQ
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      1 to 413
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No.: AAH02057

Specifications

Our Abpromise guarantee covers the use of ab201889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 88% PBS, 10% Glycerol, 0.02% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AATC_HUMAN
    • Aspartate aminotransferase
    • Aspartate aminotransferase 1
    • Aspartate aminotransferase cytoplasmic
    • Aspartate aminotransferase cytosolic
    • ASTQTL1
    • cAspAT
    • cCAT
    • cysteine aminotransferase, cytoplasmic
    • cysteine transaminase, cytoplasmic
    • cytoplasmic
    • ec 2.6.1.1
    • GIG 18
    • GIG18
    • Glutamate oxaloacetate transaminase 1
    • Glutamate oxaloacetate transaminase soluble
    • Glutamic oxaloacetic transaminase 1 soluble
    • GOT 1
    • GOT1
    • Growth inhibiting protein 18
    • SGOT
    • Transaminase A
    see all
  • Function

    Plays a key role in amino acid metabolism.
  • Sequence similarities

    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab201889 (3 µg)

References

ab201889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up