Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Mouse
    • Sequence
      AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIAD SDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYT DPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIAR LEEGDEIQLAIPRENAQISRNGDDTFFGALKLL
    • Molecular weight
      17 kDa including tags
    • Amino acids
      127 to 309
    • Tags
      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Binds to Human (weak) and mouse BCMA, TACI and BAFF-R.
    Mediates splenocyte survival.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    Binds to Human (weak) and mouse BCMA, TACI and BAFF-R.
    Mediates splenocyte survival.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 100µl sterile water to a concentration of 0.1 mg/ml. Further dilutions should be made with medium containing 5% fetal calf serum or other carrier protein. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • ApoL related ligand TALL 1
    • B cell Activating Factor
    • B lymphocyte stimulator
    • B-cell-activating factor
    • BAFF
    • BLyS
    • CD 257
    • CD257
    • CD257 antigen
    • Delta BAFF
    • Dendritic cell derived TNF like molecule
    • Dendritic cell-derived TNF-like molecule
    • DTL
    • DTL precursor
    • PRO738
    • soluble form
    • TALL 1
    • TALL-1
    • TALL1
    • THANK
    • TN13B_HUMAN
    • TNF and APOL related leukocyte expressed ligand 1
    • TNF homolog that activates apoptosis
    • TNF homolog that activates apoptosis NKFB and JNK.
    • TNF- and APOL-related leukocyte expressed ligand 1
    • TNFSF13B
    • TNFSF20
    • TNLG7A
    • Tumor necrosis factor (ligand) superfamily member 13b
    • Tumor necrosis factor ligand 7A
    • Tumor necrosis factor ligand superfamily member 13b
    • Tumor necrosis factor ligand superfamily member 20
    • Tumor necrosis factor like protein ZTNF4
    • Tumor necrosis factor superfamily member 13B
    • UNQ401
    • ZTNF4
    see all
  • Function
    Cytokine that binds to TNFRSF13B/TACI and TNFRSF17/BCMA. TNFSF13/APRIL binds to the same 2 receptors. Together, they form a 2 ligands -2 receptors pathway involved in the stimulation of B-and T-cell function and the regulation of humoral immunity. A third B-cell specific BAFF-receptor (BAFFR/BR3) promotes the survival of mature B-cells and the B-cell response.
  • Tissue specificity
    Abundantly expressed in peripheral blood Leukocytes and is specifically expressed in monocytes and macrophages. Also found in the spleen, lymph node, bone marrow, T-cells and dendritic cells. A lower expression seen in placenta, heart, lung, fetal liver, thymus, and pancreas.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications
    The soluble form derives from the membrane form by proteolytic processing.
    N-glycosylated.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis: Lane 1: MWt Marker, Lane 2: 1 µg ab157285, stained with Imperial stain
  • ab157285 mediates survival of freshly isolated splenocytes.

    Method: On day 0 splenocytes were isolated from a freshly collected C57Bl6 spleen. An aliquot of the splenocytes was analyzed on FACS and gated on the SSC-FSC panel. FACS settings were saved. The rest of the cells was put in culture with media alone or with increasing concentrations of ab157285 as indicated. After three days in culture, cells were harvested and analyzed on FACS with the saved setting. Splenocytes Survival Index (ratio % living/% dead cells) was calculated and plotted.

References

ab157285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up