Description

  • Product name

    Recombinant Mouse Bax protein (Tagged)
    See all Bax proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab228816 is purified by proprietary chromatographic techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQP PQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMF ADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLV WIQDQGGWEGLLSYFGTPTWQ
    • Predicted molecular weight

      19 kDa
    • Amino acids

      1 to 171
    • Additional sequence information

      GST tagged.

Specifications

Our Abpromise guarantee covers the use of ab228816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.16% Tris HCl, 0.87% Sodium chloride, 10% Glycerol, 0.1% Tween, 0.31% Glutathione, 0.03% EDTA

General Info

  • Alternative names

    • Apoptosis regulator BAX
    • BAX
    • Bax-protein
    • BAX_HUMAN
    • BAXA
    • Baxdelta2G9
    • Baxdelta2G9omega
    • Baxdelta2omega
    • Bcl-2-like protein 4
    • BCL2 associated X protein
    • BCL2 associated X protein omega
    • BCL2 associated X protein transcript variant delta2
    • Bcl2-L-4
    • BCL2L4
    • membrane isoform alpha
    see all
  • Function

    Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
  • Tissue specificity

    Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro-myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T-cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.
  • Sequence similarities

    Belongs to the Bcl-2 family.
  • Domain

    Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.
  • Cellular localization

    Cytoplasm and Mitochondrion membrane. Cytoplasm. Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane.
  • Information by UniProt

References

ab228816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab228816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up