Description

  • Product name

    Recombinant Mouse BNIP3 protein (His tag)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGR SSSKSSHCDSPPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVE SILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIF SADFLK
    • Predicted molecular weight

      22 kDa including tags
    • Amino acids

      1 to 156
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab235015 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • BCL2 Adenovirus E1B 19kDa Interacting Protein 3
    • BCL2/adenovirus E1B 19 kDa protein interacting protein 3
    • BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
    • BNIP 3
    • BNIP3
    • BNIP3_HUMAN
    • NIP 3
    • NIP3
    see all
  • Function

    Apoptosis-inducing protein that, which can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2.
  • Sequence similarities

    Belongs to the NIP3 family.
  • Cellular localization

    Mitochondrion. Mitochondrion membrane. Coexpression with the EIB 19-kDa protein results in a shift in NIP3 localization pattern to the nuclear envelope. Colocalizes with ACAA2 in the mitochondria.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235015.

References

ab235015 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235015.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up