Description

  • Product name

    Recombinant mouse BTC protein
    See all BTC proteins and peptides
  • Biological activity

    The ED50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 0.01 ng/mL, corresponding to a specific activity of > 1.0 x 108 IU/mg.

  • Purity

    > 96 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGR CRFVVDEQTPSCICEKGYFGARCERVDLFY
    • Predicted molecular weight

      9 kDa
    • Amino acids

      32 to 111
    • Additional sequence information

      This product is for the mature full length protein. A monomeric protein.

Specifications

Our Abpromise guarantee covers the use of ab200293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Protein previously labeled as Betacellulin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store under desiccating conditions.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

General Info

  • Alternative names

    • Betacellulin
    • Betacellulin precursor
    • BTC
    • BTC_HUMAN
    • OTTHUMP00000160600
    • OTTHUMP00000219057
    • Probetacellulin
    see all
  • Function

    Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells. The effects of betacellulin are probably mediated by the EGF receptor and other related receptors.
  • Tissue specificity

    Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.
  • Sequence similarities

    Contains 1 EGF-like domain.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

References

ab200293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up