Recombinant Mouse CAMK2N1 protein (ab219475)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Mouse
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSEVLPYGDEKLSPYGDGGDVGQIFSC RLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPG V
    • Molecular weight

      11 kDa
    • Amino acids

      1 to 78
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Reference Sequence: NP_079727.1.

Specifications

Our Abpromise guarantee covers the use of ab219475 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.5
    Constituents: 0.32% Tris HCl, 0.02% DTT, 0.58% Sodium chloride, 10% Glycerol

General Info

  • Alternative names

    • Calcium/calmodulin-dependent protein kinase II inhibitor 1
    • Camk2n1
    • CK2N1_HUMAN
  • Function

    Potent and specific inhibitor of CaM-kinase II (CAMK2).
  • Sequence similarities

    Belongs to the CAMK2N family.
  • Cellular localization

    Cell junction > synapse > synaptosome. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab219475 (3µg).

References

ab219475 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219475.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up