Recombinant Mouse Carboxylesterase 1C protein (His tag) (ab226240)

Description

  • Product name

    Recombinant Mouse Carboxylesterase 1C protein (His tag)
    See all Carboxylesterase 1C proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Yeast
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      HSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPLGSLRFAPP QPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLY LNIYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTI QYRLGIWGLFSTGDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIF GESSGGISVSVLVLSPLGKDLFHRAISESGVVINTNVGKKNIQAVNEIIA TLSQCNDTSSAAMVQCLRQKTESELLEISGKLVQYNISLSTMIDGVVLPK APEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKMNEETASLL LRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAV LLSRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLL KEGASEEETNLSKMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGA TTQQAQRLKAEEVAFWTELLAKNPPETDPTEH
    • Predicted molecular weight

      61 kDa including tags
    • Amino acids

      19 to 550
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab226240 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Carboxylesterase 1C
    • Ces N
    • Ces1c
    • Ee 1
    • Ee 4
    • Ee1
    • Es N
    • Es1
    • Es4
    • EsN
    • EST1C_MOUSE
    • Esterase 1
    • Liver carboxylesterase N
    • Lung surfactant convertase
    • PES-N
    • PESN
    see all
  • Function

    Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Involved in the extracellular metabolism of lung surfactant.
  • Tissue specificity

    Expressed in lung, kidney and liver.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
  • Cellular localization

    Endoplasmic reticulum lumen. Microsomal membrane, lumen of endoplasmic reticulum.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab226240 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ces1c.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab226240 could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Ces1c.

References

ab226240 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226240.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up