Description

  • Product name

    Recombinant Mouse Cardiac Troponin I protein (His tag)
    See all Cardiac Troponin I proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      ADESSDAAGEPQPAPAPVRRRSSANYRAYATEPHAKKKSKISASRKLQLK TLMLQIAKQEMEREAEERRGEKGRVLRTRCQPLELDGLGFEELQDLCRQL HARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRIS ADAMMQALLGTRAKESLDLRAHLKQVKKEDIEKENREVGDWRKNIDALSG MEGRKKKFEG
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      2 to 211
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab226425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • cardiac muscle
    • Cardiac troponin I
    • cardiomyopathy, dilated 2A (autosomal recessive)
    • Cardiomyopathy, familial hypertrophic, 7, included
    • CMD1FF
    • CMD2A
    • CMH7
    • cTnI
    • Familial hypertrophic cardiomyopathy 7
    • MGC116817
    • RCM1
    • Tn1
    • Tni
    • TNN I3
    • TNNC 1
    • TNNC1
    • TNNI3
    • TNNI3_HUMAN
    • Troponin I
    • Troponin I cardiac
    • Troponin I cardiac muscle
    • Troponin I cardiac muscle isoform
    • Troponin I type 3 cardiac
    • troponin I, cardiac 3
    • TroponinI
    • Ttroponin I type 3 (cardiac)
    see all
  • Function

    Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
  • Involvement in disease

    Defects in TNNI3 are the cause of cardiomyopathy familial hypertrophic type 7 (CMH7) [MIM:613690]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
    Defects in TNNI3 are the cause of cardiomyopathy familial restrictive type 1 (RCM1) [MIM:115210]. RCM1 is an heart muscle disorder characterized by impaired filling of the ventricles with reduced diastolic volume, in the presence of normal or near normal wall thickness and systolic function.
    Defects in TNNI3 are the cause of cardiomyopathy dilated type 2A (CMD2A) [MIM:611880]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
    Defects in TNNI3 are the cause of cardiomyopathy dilated type 1FF (CMD1FF) [MIM:613286]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
  • Sequence similarities

    Belongs to the troponin I family.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226425 with 5% enrichment gel and 15% separation gel.

References

ab226425 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up