Description

  • Product name

    Recombinant Mouse Cathepsin L/MEP protein
    See all Cathepsin L/MEP proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      TPKFDQTFSAEWHQWKSTHRRLYGTNEEEWRRAIWEKNMRMIQLHNGEYS NGQHGFSMEMNAFGDMTNEEFRQVVNGYRHQKHKKGRLFQEPLMLKIPKS VDWREKGCVTPVKNQGQCGSCWAFSASGCLEGQMFLKTGKLISLSEQNLV DCSHAQGNQGCNGGLMDFAFQYIKENGGLDSEESYPYEAKDGSCKYRAEF AVANDTGFVDIPQQEKALMKAVATVGPISVAMDASHPSLQFYSSGIYYEP NCSSKNLDHGVLLVGYGYEGTDSNKNKYWLVKNSWGSEWGMEGYIKIAKD RDNHCGLATAASYPVVNLEHHHHHH
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      18 to 334
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 18 to 334 including the propeptide. The signal peptide is not included.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab222438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Cathepsin L
    • cathepsin L, 1 b
    • Cathepsin L1
    • Cathepsin L1 light chain
    • CathepsinL
    • CATL
    • CATL1_HUMAN
    • cb15
    • CTSL
    • CTSL1
    • ctsl1b
    • FLJ31037
    • hgg1
    • Major excreted protein
    • MEP
    • MGC123162
    • wu:fb30g09
    see all
  • Function

    Important for the overall degradation of proteins in lysosomes.
  • Sequence similarities

    Belongs to the peptidase C1 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • 3 μg ab222438 analyzed by 15% SDS-PAGE.

References

ab222438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up