Description

  • Product name

    Recombinant Mouse Cathepsin S protein (His tag)
    See all Cathepsin S proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab222431 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      VAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIH NLEYSMGMHTYQVGMNDMGDMTNEEISCRMGALRISRQSPKTVTFRSYSN RTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISL SAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDE KCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFF YKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIR MARNNKNHCGIASYCSYPEILEHHHHHHDYWLVKNSWGNFGDQGYIRMAR NNKNHCGIASYCSYPEILEHHHHHH
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      21 to 340
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the full length protein from aa 21 to 340, containing the mature chain and the majority of the propeptide. The signal peptide is not included (NP_067256).

Specifications

Our Abpromise guarantee covers the use of ab222431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Cathepsin S
    • CathepsinS
    • CATS_HUMAN
    • Ctss
  • Function

    Thiol protease. Key protease responsible for the removal of the invariant chain from MHC class II molecules. The bond-specificity of this proteinase is in part similar to the specificities of cathepsin L and cathepsin N.
  • Sequence similarities

    Belongs to the peptidase C1 family.
  • Cellular localization

    Lysosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222431.

    MWt 28-40 kDa (SDS–PAGE under reducing conditions).

References

ab222431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up