Recombinant Mouse Ccl21a protein (ab173056)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Suitable for: SDS-PAGE, HPLC
Description
-
Product name
Recombinant Mouse Ccl21a protein -
Purity
> 95 % SDS-PAGE.
ab173056 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µM filtered solution. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Mouse -
Sequence
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPE LCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCK RTEQTQPSRG -
Predicted molecular weight
12 kDa -
Amino acids
24 to 133
-
Associated products
Specifications
Our Abpromise guarantee covers the use of ab173056 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
General Info
-
Alternative names
- 6Ckine
- Beta-chemokine exodus-2
- C-C motif chemokine 21a
see all -
Function
Inhibits hemopoiesis and stimulates chemotaxis. Chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Potent mesangial cell chemoattractant. Shows preferential activity towards naive T-cells. May play a role in mediating homing of lymphocytes to secondary lymphoid organs. -
Tissue specificity
Expressed strongly in lung, spleen, thymus, peripheral and mesentric lymph nodes. Also expressed in the testis, kidney, liver, and heart. -
Involvement in disease
Note=Mice carrying an autosomal recessive mutation designated paucity of lymph node T-cells (plt) show dramatically reduced numbers of T-cells in lymph nodes, Peyer patches, and the white pulp of the spleen. Plt seems to correspond to Scya21b. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab173056 has not yet been referenced specifically in any publications.