Description

  • Product name

    Recombinant mouse CCL25 protein
    See all CCL25 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard.

    The ED50 determined by a chemotaxis bioassay using Human CCR9 transfected BaF3 murine proB cells is less than 500 ng/ml, corresponding to a specific activity of >2×103 IU/mg.

  • Purity

    > 95 % SDS-PAGE.
    >95% by HPLC analysis.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVC GNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNST SVRSATLGHPRMVMMPRKTNN
    • Predicted molecular weight

      14 kDa
    • Amino acids

      24 to 144
    • Additional sequence information

      Single, non-glycosylated polypeptide chain. This product is the mature full length protein from aa 24 to 144. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab201368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as TECK

     

     This product was previously labelled as TECK

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Lyophilized from a 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at -20°C to -70°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • A130072A22Rik
    • C-C motif chemokine 25
    • CCL 25
    • CCL25
    • CCL25_HUMAN
    • Chemokine (C C motif) ligand 25
    • Chemokine (CC motif) ligand 25
    • Chemokine C C motif ligand 25
    • Chemokine CC motif ligand 25
    • Chemokine TECK
    • Ck beta 15
    • Ckb 15
    • Ckb15
    • MGC125074
    • MGC150327
    • SCY A25
    • SCYA 25
    • SCYA25
    • Small inducible cytokine A25
    • Small inducible cytokine A25 isoform 1 precursor
    • Small inducible cytokine A25 isoform 2 precursor
    • Small inducible cytokine subfamily A (Cys Cys) member 25
    • Small inducible cytokine subfamily A Cys Cys member 25
    • Small inducible cytokine subfamily A, member 25
    • Small-inducible cytokine A25
    • TECK
    • TECKvar
    • Thymus expressed chemokine
    • Thymus-expressed chemokine
    see all
  • Function

    Potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. Binds to CCR9. Isoform 2 is an antagonist of isoform 1.
  • Tissue specificity

    Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab201368 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up