Description

  • Product name

    Recombinant mouse CCL28/MEC protein
    See all CCL28/MEC proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. Determined by its ability to chemoattract murine lymphocytes using a concentration range of 1.0-10.0 ng/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC analysis
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKR RRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHR TRGTHRHEASR
    • Predicted molecular weight

      13 kDa
    • Amino acids

      20 to 130
    • Additional sequence information

      A single, non-glycosylated polypeptide chain containing 111 amino acids.

Specifications

Our Abpromise guarantee covers the use of ab201426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as CCL28

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • C C motif chemokine ligand 28
    • C-C motif chemokine 28
    • CC chemokine CCL28
    • CCK 1
    • CCK1
    • CCK1 protein
    • CCL 28
    • CCL28
    • CCL28_HUMAN
    • Chemokine (C-C motif) ligand 28
    • chemokine (C-C motif) ligand 28 splice variant chi
    • MEC
    • Mucosae associated epithelial chemokine
    • Mucosae-associated epithelial chemokine
    • Protein CCK1
    • SCYA28
    • Small inducible cytokine A28 [Precursor]
    • small inducible cytokine subfamily A (Cys-Cys), member 28
    • Small-inducible cytokine A28
    see all
  • Function

    Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner.
  • Tissue specificity

    Preferentially expressed by epithelial cells of diverse tissues including normal and pathological colon, salivary gland, mammary gland, trachea and rectum. Also found in prostate, spleen, thyroid, psoriasis skin and in lower levels in peripheral blood leukocytes, small intestine, Peyer patches, stomach and normal skin.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab201426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up