Description

  • Product name

    Recombinant Mouse CCRK protein
    See all CCRK proteins and peptides
  • Purity

    > 80 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGIPNQALR EIKALQEIEDSQYVVQLKAVFPHGAGFVLAFEFMLSDLAEVVRHAQRPLA PAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLAR VFSPDGGRLYTHQVATRWYRAPELLYGARQYDQGVDLWAVGCIMGELLNG SPLFPGENDIEQLCCVLRILGTPSPRVWPEITELPDYNKI SFKEQAPV PLEEVLPDASPQALDLLGQFLLYPPRQRIAASQALLHQYFFTAPLPAHPS ELPIPQRPGGPAPKAHPGPPHVHDFHVDRPLEESLLNPELIRPFIPEG
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      1 to 346
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_053180.

Specifications

Our Abpromise guarantee covers the use of ab204163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.002% PMSF, 0.004% DTT, 25% Glycerol

General Info

  • Alternative names

    • CAK kinase p42
    • CAK-kinase p42
    • CCRK
    • CDCH
    • CDK activating kinase p42
    • CDK-activating kinase p42
    • cdk20
    • CDK20_HUMAN
    • Cell cycle related kinase
    • Cell cycle-related kinase
    • Cell division protein kinase 20
    • Cyclin dependent protein kinase H
    • Cyclin kinase activating kinase p42
    • Cyclin-dependent kinase 20
    • Cyclin-dependent protein kinase H
    • Cyclin-kinase-activating kinase p42
    • p42
    • PNQALRE
    see all
  • Function

    Required for high-level Shh responses in the developing neural tube. Together with BROMI, controls the structure of the primary cilium by coordinating assembly of the ciliary membrane and axoneme, allowing GLI2 to be properly activated in response to SHH signaling (By similarity). Involved in cell growth. Activates CDK2, a kinase involved in the control of the cell cycle, by phosphorylating residue 'Thr-160'.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Nucleus. Cytoplasm. Cell projection > cilium.
  • Information by UniProt

Images

  • Analysis of the purity of ab204163 by densitometry.

References

ab204163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up