Bioactive grade

Recombinant mouse CD134 / OX40L receptor protein (Active) (ab221028)

Description

  • Product name

    Recombinant mouse CD134 / OX40L receptor protein (Active)
    See all CD134 / OX40L receptor proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab221028 at 2 μg/mL (100 μl/well) can bind mouse CD134 / OX40 Ligand, Fc Tag with a linear range of 2-30 ng/mL.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYN EAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKL GVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSL LATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      20 to 211
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_035789).

Specifications

Our Abpromise guarantee covers the use of ab221028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • ACT 35
    • ACT35
    • ACT35 antigen
    • ATC35 antigen
    • CD 134
    • CD134
    • CD134 antigen
    • IMD16
    • Lymphoid activation antigene ACT35
    • OX 40
    • OX40
    • OX40 antigen
    • OX40 cell surface antigen
    • OX40 homologue
    • OX40L receptor
    • TAX transcriptionally activated glycoprotein 1 receptor
    • TAX transcriptionally-activated glycoprotein 1 receptor
    • TNF receptor superfamily member 4
    • TNFRSF 4
    • TNFRSF4
    • TNR4_HUMAN
    • Tumor necrosis factor receptor superfamily member 4
    • Txgp 1l
    • Txgp1
    • Txgp1l
    see all
  • Function

    Receptor for TNFSF4/OX40L/GP34.
  • Sequence similarities

    Contains 4 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Immobilized Mouse OX40 Ligand (Fc Tag) at 2 µg/mL (100 µL/well) can bind Mouse OX40 (His Tag) with a linear range of 3.9-31.3 ng/mL (QC tested).
  • Mouse OX40 (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.
  • Immobilized ab221028 at 2 μg/mL (100 μl/well) can bind mouse CD134 / OX40 Ligand, Fc Tag with a linear range of 2-30 ng/mL.

  • SDS-PAGE analysis of reduced ab221028 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 45 kDa in SDS-PAGE due to glycosylation.

References

ab221028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up